PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G397100.1.p
Common NameLOC101756332, SETIT_022727mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GATA
Protein Properties Length: 313aa    MW: 35241.1 Da    PI: 8.5843
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G397100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA36.85.4e-12161191131
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyr 31 
                         CsnC + +Tp WR+gp+g  +LCnaCGl+ +
  Seita.3G397100.1.p 161 CSNCLSCETPRWRNGPSGIQMLCNACGLRLK 191
                         ****************************987 PP

2GATA57.12.5e-18243277135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C++C ++kTp+WR+gp g+ktLCnaCG++y++ +l
  Seita.3G397100.1.p 243 CTHCMSSKTPQWRSGPLGPKTLCNACGVRYKSGRL 277
                         *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.914155209IPR000679Zinc finger, GATA-type
SMARTSM004014.0E-9155209IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.5E-11158196No hitNo description
CDDcd002022.64E-10160191No hitNo description
Gene3DG3DSA:3.30.50.107.6E-13160194IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440161186IPR000679Zinc finger, GATA-type
PfamPF003208.2E-10161191IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.859237273IPR000679Zinc finger, GATA-type
SMARTSM004014.5E-16237291IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.52E-14240301No hitNo description
Gene3DG3DSA:3.30.50.104.4E-14241275IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.73E-13242299No hitNo description
PROSITE patternPS003440243268IPR000679Zinc finger, GATA-type
PfamPF003204.0E-16243277IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MDVHSANAAA DSLGDLFPHQ AAALESDESN LEWLSGYVED CFSSSTSYTN PVFARPAPTM  60
ANQGAGKPKL PPPPPSNGRR KRRSLASVMG NDDDQQYIIP LYVEPPLLLI DQKHWMAESE  120
LILPKKDKDQ EVCQQQEQEQ EEEKCEKGAL VPRQERLVKR CSNCLSCETP RWRNGPSGIQ  180
MLCNACGLRL KPENRFATIS EEHYSQETKK EQEPGKRLDK KKKMIKKTYV SKELSSEQAE  240
KRCTHCMSSK TPQWRSGPLG PKTLCNACGV RYKSGRLLPE YRPANSPTFV SCLHSNSHKK  300
VMQMRQAIAY KE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1215222KRLDKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963249.10.0PREDICTED: GATA transcription factor 2-like
TrEMBLK3Z8570.0K3Z857_SETIT; Uncharacterized protein
STRINGSi022727m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.18e-35GATA transcription factor 4